Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,006

  1. Avatar for alwen 51. alwen Lv 1 35 pts. 8,819
  2. Avatar for deLaCeiba 52. deLaCeiba Lv 1 35 pts. 8,809
  3. Avatar for jobo0502 53. jobo0502 Lv 1 34 pts. 8,800
  4. Avatar for smilingone 54. smilingone Lv 1 33 pts. 8,794
  5. Avatar for goastano 55. goastano Lv 1 32 pts. 8,792
  6. Avatar for Threeoak 56. Threeoak Lv 1 31 pts. 8,779
  7. Avatar for pvc78 57. pvc78 Lv 1 31 pts. 8,768
  8. Avatar for uhuuhu 58. uhuuhu Lv 1 30 pts. 8,767
  9. Avatar for Deleted player 59. Deleted player 29 pts. 8,759
  10. Avatar for pfeiffelfloyd 60. pfeiffelfloyd Lv 1 29 pts. 8,746

Comments