1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Summary

• Created: July 13, 2015
• Expires: July 21, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

• 1. L'Alliance Francophone 100 pts. 9,204
• 2. Beta Folders 78 pts. 9,153
• 3. Gargleblasters 60 pts. 9,138
• 4. Contenders 45 pts. 9,078
• 5. Go Science 33 pts. 9,052
• 6. Anthropic Dreams 24 pts. 8,988
• 7. Deleted group pts. 8,911
• 8. Deleted group pts. 8,901
• 9. Void Crushers 8 pts. 8,886
• 10. HMT heritage 6 pts. 8,685

Top soloists

• 81. pmdpmd 15 pts. 8,522
• 82. ecali 15 pts. 8,514
• 83. Soggy Doglog 14 pts. 8,487
• 84. ManVsYard 14 pts. 8,482
• 85. Mr_Jolty 14 pts. 8,454
• 86. Festering Wounds 13 pts. 8,454
• 87. TJOK fan 13 pts. 8,452
• 88. Jajaboman 13 pts. 8,425
• 89. DodoBird 12 pts. 8,416
• 90. Tweedle Dumb 12 pts. 8,390