Placeholder image of a protein
Icon representing a puzzle

1113: Revisiting Puzzle 82: Cytotoxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 9,204
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,153
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,138
  4. Avatar for Contenders 4. Contenders 45 pts. 9,078
  5. Avatar for Go Science 5. Go Science 33 pts. 9,052
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 8,988
  7. Avatar for Deleted group 7. Deleted group pts. 8,911
  8. Avatar for Deleted group 8. Deleted group pts. 8,901
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 8,886
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 8,685
  1. Avatar for Duke_K 211. Duke_K Lv 1 1 pt. 6,937
  2. Avatar for Siemy 212. Siemy Lv 1 1 pt. 6,932
  3. Avatar for cynwulf28 213. cynwulf28 Lv 1 1 pt. 6,929
  4. Avatar for tomsd 214. tomsd Lv 1 1 pt. 6,908
  5. Avatar for marcus123 215. marcus123 Lv 1 1 pt. 6,901
  6. Avatar for poiuyqwert 216. poiuyqwert Lv 1 1 pt. 6,898
  7. Avatar for mario56865 217. mario56865 Lv 1 1 pt. 6,896
  8. Avatar for marie30412 218. marie30412 Lv 1 1 pt. 6,893
  9. Avatar for brgreening 219. brgreening Lv 1 1 pt. 6,890
  10. Avatar for lyco013 220. lyco013 Lv 1 1 pt. 6,882

Comments