Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for hoglahoo 181. hoglahoo Lv 1 1 pt. 7,200
  2. Avatar for Lucane 182. Lucane Lv 1 1 pt. 7,139
  3. Avatar for dbuske 183. dbuske Lv 1 1 pt. 7,116
  4. Avatar for AgentGhost 184. AgentGhost Lv 1 1 pt. 7,071
  5. Avatar for wilding2004 185. wilding2004 Lv 1 1 pt. 6,973
  6. Avatar for Viz 186. Viz Lv 1 1 pt. 6,923
  7. Avatar for lange 187. lange Lv 1 1 pt. 6,863
  8. Avatar for rezaefar 188. rezaefar Lv 1 1 pt. 6,861
  9. Avatar for cherry39 189. cherry39 Lv 1 1 pt. 6,852
  10. Avatar for DScott 190. DScott Lv 1 1 pt. 6,818

Comments