Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,503
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 11,010
  3. Avatar for Go Science 3. Go Science 61 pts. 10,954
  4. Avatar for Void Crushers 4. Void Crushers 47 pts. 10,943
  5. Avatar for Contenders 5. Contenders 35 pts. 10,882
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 10,794
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,675
  8. Avatar for Deleted group 8. Deleted group pts. 10,559
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,387
  10. Avatar for xkcd 10. xkcd 7 pts. 10,064
  1. Avatar for hoglahoo 181. hoglahoo Lv 1 1 pt. 7,200
  2. Avatar for Lucane 182. Lucane Lv 1 1 pt. 7,139
  3. Avatar for dbuske 183. dbuske Lv 1 1 pt. 7,116
  4. Avatar for AgentGhost 184. AgentGhost Lv 1 1 pt. 7,071
  5. Avatar for wilding2004 185. wilding2004 Lv 1 1 pt. 6,973
  6. Avatar for Viz 186. Viz Lv 1 1 pt. 6,923
  7. Avatar for lange 187. lange Lv 1 1 pt. 6,863
  8. Avatar for rezaefar 188. rezaefar Lv 1 1 pt. 6,861
  9. Avatar for cherry39 189. cherry39 Lv 1 1 pt. 6,852
  10. Avatar for DScott 190. DScott Lv 1 1 pt. 6,818

Comments