Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for alcor29 11. alcor29 Lv 1 82 pts. 10,798
  2. Avatar for nicobul 12. nicobul Lv 1 80 pts. 10,794
  3. Avatar for hansvandenhof 13. hansvandenhof Lv 1 79 pts. 10,781
  4. Avatar for Bautho 14. Bautho Lv 1 77 pts. 10,765
  5. Avatar for grogar7 15. grogar7 Lv 1 75 pts. 10,753
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 74 pts. 10,751
  7. Avatar for Mike Cassidy 17. Mike Cassidy Lv 1 72 pts. 10,747
  8. Avatar for Vredeman 18. Vredeman Lv 1 71 pts. 10,724
  9. Avatar for bertro 19. bertro Lv 1 69 pts. 10,712
  10. Avatar for Roukess 20. Roukess Lv 1 68 pts. 10,703

Comments