Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for CHNO Junkies 21. CHNO Junkies 1 pt. 0
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  1. Avatar for larry25427 211. larry25427 Lv 1 1 pt. 5,556
  2. Avatar for Hansie 212. Hansie Lv 1 1 pt. 5,503
  3. Avatar for smarthuman 213. smarthuman Lv 1 1 pt. 5,496
  4. Avatar for ScientistMan 214. ScientistMan Lv 1 1 pt. 5,485
  5. Avatar for Ansh145 215. Ansh145 Lv 1 1 pt. 5,480
  6. Avatar for pandabearsecond 216. pandabearsecond Lv 1 1 pt. 5,421
  7. Avatar for may of rose 217. may of rose Lv 1 1 pt. 5,384
  8. Avatar for Malahide 218. Malahide Lv 1 1 pt. 5,340
  9. Avatar for smcclosk 219. smcclosk Lv 1 1 pt. 5,260
  10. Avatar for nunuyuan 220. nunuyuan Lv 1 1 pt. 5,240

Comments