Placeholder image of a protein
Icon representing a puzzle

1114: Unsolved De-novo Freestyle 53: Predicted Contacts

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts

Summary


Created
July 15, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1111, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1111 and use them as a starting point here.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,503
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 11,010
  3. Avatar for Go Science 3. Go Science 61 pts. 10,954
  4. Avatar for Void Crushers 4. Void Crushers 47 pts. 10,943
  5. Avatar for Contenders 5. Contenders 35 pts. 10,882
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 10,794
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,675
  8. Avatar for Deleted group 8. Deleted group pts. 10,559
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,387
  10. Avatar for xkcd 10. xkcd 7 pts. 10,064

  1. Avatar for larry25427 211. larry25427 Lv 1 1 pt. 5,556
  2. Avatar for Hansie 212. Hansie Lv 1 1 pt. 5,503
  3. Avatar for smarthuman 213. smarthuman Lv 1 1 pt. 5,496
  4. Avatar for ScientistMan 214. ScientistMan Lv 1 1 pt. 5,485
  5. Avatar for Ansh145 215. Ansh145 Lv 1 1 pt. 5,480
  6. Avatar for pandabearsecond 216. pandabearsecond Lv 1 1 pt. 5,421
  7. Avatar for may of rose 217. may of rose Lv 1 1 pt. 5,384
  8. Avatar for Malahide 218. Malahide Lv 1 1 pt. 5,340
  9. Avatar for smcclosk 219. smcclosk Lv 1 1 pt. 5,260
  10. Avatar for nunuyuan 220. nunuyuan Lv 1 1 pt. 5,240

Comments