Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for PrettyPony2001 91. PrettyPony2001 Lv 1 11 pts. 8,612
  2. Avatar for phi16 92. phi16 Lv 1 11 pts. 8,611
  3. Avatar for smholst 93. smholst Lv 1 10 pts. 8,582
  4. Avatar for alwen 94. alwen Lv 1 10 pts. 8,580
  5. Avatar for pfeiffelfloyd 95. pfeiffelfloyd Lv 1 10 pts. 8,564
  6. Avatar for fishercat 96. fishercat Lv 1 9 pts. 8,550
  7. Avatar for arginia 97. arginia Lv 1 9 pts. 8,511
  8. Avatar for Colostomy EXPLOSION. 98. Colostomy EXPLOSION. Lv 1 9 pts. 8,500
  9. Avatar for Festering Wounds 99. Festering Wounds Lv 1 8 pts. 8,479
  10. Avatar for Mohambone 100. Mohambone Lv 1 8 pts. 8,469

Comments