Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370
  1. Avatar for LociOiling 11. LociOiling Lv 1 82 pts. 9,153
  2. Avatar for jermainiac 12. jermainiac Lv 1 80 pts. 9,139
  3. Avatar for pauldunn 13. pauldunn Lv 1 78 pts. 9,138
  4. Avatar for aznarog 14. aznarog Lv 1 77 pts. 9,137
  5. Avatar for bertro 15. bertro Lv 1 75 pts. 9,131
  6. Avatar for Lindata 16. Lindata Lv 1 74 pts. 9,130
  7. Avatar for Galaxie 17. Galaxie Lv 1 72 pts. 9,129
  8. Avatar for johnmitch 18. johnmitch Lv 1 71 pts. 9,126
  9. Avatar for mirp 19. mirp Lv 1 69 pts. 9,125
  10. Avatar for gloverd 20. gloverd Lv 1 68 pts. 9,123

Comments