Placeholder image of a protein
Icon representing a puzzle

1119: Revisiting Puzzle 84: Giant Anemone

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Jorks! 21. Jorks! 1 pt. 7,685
  2. Avatar for CureCoin 22. CureCoin 1 pt. 7,192
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,114
  4. Avatar for Window Group 24. Window Group 1 pt. 3,370

  1. Avatar for actiasluna 31. actiasluna Lv 1 53 pts. 9,077
  2. Avatar for Vredeman 32. Vredeman Lv 1 52 pts. 9,077
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 50 pts. 9,076
  4. Avatar for uhuuhu 34. uhuuhu Lv 1 49 pts. 9,053
  5. Avatar for Amphimixus 35. Amphimixus Lv 1 48 pts. 9,052
  6. Avatar for dcrwheeler 36. dcrwheeler Lv 1 47 pts. 9,044
  7. Avatar for Timo van der Laan 37. Timo van der Laan Lv 1 46 pts. 9,039
  8. Avatar for Norrjane 38. Norrjane Lv 1 45 pts. 9,034
  9. Avatar for DodoBird 39. DodoBird Lv 1 44 pts. 9,032
  10. Avatar for smilingone 40. smilingone Lv 1 43 pts. 9,022

Comments