Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110
  1. Avatar for AryehK 141. AryehK Lv 1 1 pt. 7,575
  2. Avatar for Soggy Doglog 142. Soggy Doglog Lv 1 1 pt. 7,565
  3. Avatar for bamh 143. bamh Lv 1 1 pt. 7,515
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 7,505
  5. Avatar for Jumbly 145. Jumbly Lv 1 1 pt. 7,500
  6. Avatar for taminnugget 146. taminnugget Lv 1 1 pt. 7,486
  7. Avatar for jencimons 147. jencimons Lv 1 1 pt. 7,455
  8. Avatar for bwkittitas 148. bwkittitas Lv 1 1 pt. 7,449
  9. Avatar for Festering Wounds 149. Festering Wounds Lv 1 1 pt. 7,443
  10. Avatar for Mohambone 150. Mohambone Lv 1 1 pt. 7,430

Comments