Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Go Science 100 pts. 8,541
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 8,481
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 8,479
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 8,444
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 8,439
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 8,432
  7. Avatar for Contenders 7. Contenders 19 pts. 8,400
  8. Avatar for Deleted group 8. Deleted group pts. 8,292
  9. Avatar for xkcd 9. xkcd 10 pts. 8,146
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,107

  1. Avatar for AryehK 141. AryehK Lv 1 1 pt. 7,575
  2. Avatar for Soggy Doglog 142. Soggy Doglog Lv 1 1 pt. 7,565
  3. Avatar for bamh 143. bamh Lv 1 1 pt. 7,515
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 7,505
  5. Avatar for Jumbly 145. Jumbly Lv 1 1 pt. 7,500
  6. Avatar for taminnugget 146. taminnugget Lv 1 1 pt. 7,486
  7. Avatar for jencimons 147. jencimons Lv 1 1 pt. 7,455
  8. Avatar for bwkittitas 148. bwkittitas Lv 1 1 pt. 7,449
  9. Avatar for Festering Wounds 149. Festering Wounds Lv 1 1 pt. 7,443
  10. Avatar for Mohambone 150. Mohambone Lv 1 1 pt. 7,430

Comments