Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,038
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 7,960
  3. Avatar for Deleted group 13. Deleted group pts. 7,906
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,903
  5. Avatar for Russian team 15. Russian team 1 pt. 7,799
  6. Avatar for ROMANIA Team 16. ROMANIA Team 1 pt. 7,771
  7. Avatar for freefolder 17. freefolder 1 pt. 7,608
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,403
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,225
  10. Avatar for Geekdo 20. Geekdo 1 pt. 7,110
  1. Avatar for Superphosphate 71. Superphosphate Lv 1 14 pts. 8,050
  2. Avatar for tallguy-13088 72. tallguy-13088 Lv 1 14 pts. 8,045
  3. Avatar for lilovip 73. lilovip Lv 1 13 pts. 8,043
  4. Avatar for O Seki To 74. O Seki To Lv 1 13 pts. 8,038
  5. Avatar for Deleted player 75. Deleted player pts. 8,028
  6. Avatar for joremen 76. joremen Lv 1 12 pts. 8,026
  7. Avatar for SouperGenious 77. SouperGenious Lv 1 11 pts. 8,026
  8. Avatar for andrewxc 78. andrewxc Lv 1 11 pts. 8,012
  9. Avatar for isaksson 79. isaksson Lv 1 11 pts. 8,005
  10. Avatar for proteansoup 80. proteansoup Lv 1 10 pts. 8,003

Comments