Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Go Science 100 pts. 8,541
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 8,481
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 8,479
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 8,444
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 8,439
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 8,432
  7. Avatar for Contenders 7. Contenders 19 pts. 8,400
  8. Avatar for Deleted group 8. Deleted group pts. 8,292
  9. Avatar for xkcd 9. xkcd 10 pts. 8,146
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,107

  1. Avatar for Superphosphate 71. Superphosphate Lv 1 14 pts. 8,050
  2. Avatar for tallguy-13088 72. tallguy-13088 Lv 1 14 pts. 8,045
  3. Avatar for lilovip 73. lilovip Lv 1 13 pts. 8,043
  4. Avatar for O Seki To 74. O Seki To Lv 1 13 pts. 8,038
  5. Avatar for Deleted player 75. Deleted player pts. 8,028
  6. Avatar for joremen 76. joremen Lv 1 12 pts. 8,026
  7. Avatar for SouperGenious 77. SouperGenious Lv 1 11 pts. 8,026
  8. Avatar for andrewxc 78. andrewxc Lv 1 11 pts. 8,012
  9. Avatar for isaksson 79. isaksson Lv 1 11 pts. 8,005
  10. Avatar for proteansoup 80. proteansoup Lv 1 10 pts. 8,003

Comments