Placeholder image of a protein
Icon representing a puzzle

1122: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 03, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,541
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 8,481
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 8,479
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 8,444
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 8,439
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 8,432
  7. Avatar for Contenders 7. Contenders 19 pts. 8,400
  8. Avatar for Deleted group 8. Deleted group pts. 8,292
  9. Avatar for xkcd 9. xkcd 10 pts. 8,146
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,107
  1. Avatar for bob1928 111. bob1928 Lv 1 3 pts. 7,844
  2. Avatar for leehaggis 112. leehaggis Lv 1 3 pts. 7,829
  3. Avatar for navn 113. navn Lv 1 3 pts. 7,818
  4. Avatar for Tweedle Dumb 114. Tweedle Dumb Lv 1 3 pts. 7,809
  5. Avatar for psen 115. psen Lv 1 3 pts. 7,807
  6. Avatar for Grom 116. Grom Lv 1 3 pts. 7,799
  7. Avatar for PuccaRO 117. PuccaRO Lv 1 2 pts. 7,771
  8. Avatar for rinze 118. rinze Lv 1 2 pts. 7,765
  9. Avatar for Ecervele 119. Ecervele Lv 1 2 pts. 7,764
  10. Avatar for tela 120. tela Lv 1 2 pts. 7,749

Comments