Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661
  1. Avatar for Mike Cassidy 51. Mike Cassidy Lv 1 31 pts. 9,319
  2. Avatar for cbwest 52. cbwest Lv 1 31 pts. 9,319
  3. Avatar for stomjoh 53. stomjoh Lv 1 30 pts. 9,312
  4. Avatar for mimi 54. mimi Lv 1 29 pts. 9,291
  5. Avatar for Amphimixus 55. Amphimixus Lv 1 28 pts. 9,283
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 28 pts. 9,283
  7. Avatar for aznarog 57. aznarog Lv 1 27 pts. 9,272
  8. Avatar for jobo0502 58. jobo0502 Lv 1 26 pts. 9,258
  9. Avatar for caglar 59. caglar Lv 1 25 pts. 9,222
  10. Avatar for Idiotboy 60. Idiotboy Lv 1 25 pts. 9,217

Comments