Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 10,031
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,983
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,919
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,918
  5. Avatar for Contenders 5. Contenders 31 pts. 9,884
  6. Avatar for Deleted group 6. Deleted group pts. 9,693
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,606
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,584
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,547
  10. Avatar for Deleted group 10. Deleted group pts. 9,283

  1. Avatar for Mike Cassidy 51. Mike Cassidy Lv 1 31 pts. 9,319
  2. Avatar for cbwest 52. cbwest Lv 1 31 pts. 9,319
  3. Avatar for stomjoh 53. stomjoh Lv 1 30 pts. 9,312
  4. Avatar for mimi 54. mimi Lv 1 29 pts. 9,291
  5. Avatar for Amphimixus 55. Amphimixus Lv 1 28 pts. 9,283
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 28 pts. 9,283
  7. Avatar for aznarog 57. aznarog Lv 1 27 pts. 9,272
  8. Avatar for jobo0502 58. jobo0502 Lv 1 26 pts. 9,258
  9. Avatar for caglar 59. caglar Lv 1 25 pts. 9,222
  10. Avatar for Idiotboy 60. Idiotboy Lv 1 25 pts. 9,217

Comments