Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,103
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,085
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,922
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,253
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,250
  6. Avatar for freefolder 16. freefolder 1 pt. 8,235
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,400
  8. Avatar for ROMANIA Team 18. ROMANIA Team 1 pt. 7,368
  9. Avatar for CureCoin 19. CureCoin 1 pt. 6,771
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,661

  1. Avatar for andrewxc 71. andrewxc Lv 1 18 pts. 9,035
  2. Avatar for alwen 72. alwen Lv 1 18 pts. 9,026
  3. Avatar for pfirth 73. pfirth Lv 1 17 pts. 8,968
  4. Avatar for ManVsYard 74. ManVsYard Lv 1 17 pts. 8,943
  5. Avatar for Satina 75. Satina Lv 1 16 pts. 8,937
  6. Avatar for deLaCeiba 76. deLaCeiba Lv 1 16 pts. 8,922
  7. Avatar for RockOn 77. RockOn Lv 1 15 pts. 8,921
  8. Avatar for molleke 78. molleke Lv 1 15 pts. 8,912
  9. Avatar for Mydogisa Toelicker 79. Mydogisa Toelicker Lv 1 14 pts. 8,901
  10. Avatar for NameChangeNeeded01 80. NameChangeNeeded01 Lv 1 14 pts. 8,898

Comments