Placeholder image of a protein
Icon representing a puzzle

1124: Revisiting Puzzle 86: Nematode

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Go Science 100 pts. 10,031
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,983
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 9,919
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,918
  5. Avatar for Contenders 5. Contenders 31 pts. 9,884
  6. Avatar for Deleted group 6. Deleted group pts. 9,693
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,606
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,584
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,547
  10. Avatar for Deleted group 10. Deleted group pts. 9,283

  1. Avatar for Timo van der Laan 31. Timo van der Laan Lv 1 52 pts. 9,584
  2. Avatar for bertro 32. bertro Lv 1 50 pts. 9,582
  3. Avatar for Deleted player 33. Deleted player 49 pts. 9,578
  4. Avatar for O Seki To 34. O Seki To Lv 1 48 pts. 9,547
  5. Avatar for pmdpmd 35. pmdpmd Lv 1 47 pts. 9,533
  6. Avatar for Museka 36. Museka Lv 1 46 pts. 9,512
  7. Avatar for pvc78 37. pvc78 Lv 1 45 pts. 9,511
  8. Avatar for egran48 38. egran48 Lv 1 44 pts. 9,509
  9. Avatar for martin.szew 39. martin.szew Lv 1 43 pts. 9,486
  10. Avatar for crpainter 40. crpainter Lv 1 42 pts. 9,478

Comments