Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for mateusxyz13 161. mateusxyz13 Lv 1 1 pt. 7,318
  2. Avatar for rezaefar 162. rezaefar Lv 1 1 pt. 7,313
  3. Avatar for piuwiu 163. piuwiu Lv 1 1 pt. 7,277
  4. Avatar for mr.Dir 164. mr.Dir Lv 1 1 pt. 7,276
  5. Avatar for Archer2150 165. Archer2150 Lv 1 1 pt. 7,244
  6. Avatar for DScott 166. DScott Lv 1 1 pt. 7,219
  7. Avatar for DarkArrow58 167. DarkArrow58 Lv 1 1 pt. 7,181
  8. Avatar for pandabearsecond 168. pandabearsecond Lv 1 1 pt. 7,166
  9. Avatar for monoleuno2015 169. monoleuno2015 Lv 1 1 pt. 7,163
  10. Avatar for zezetel 170. zezetel Lv 1 1 pt. 7,155

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.