Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups



  1. Avatar for Deleted player 51. Deleted player 38 pts. 9,030
  2. Avatar for stomjoh 52. stomjoh Lv 1 37 pts. 9,030
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 37 pts. 9,028
  4. Avatar for Mike Cassidy 54. Mike Cassidy Lv 1 36 pts. 9,024
  5. Avatar for pvc78 55. pvc78 Lv 1 35 pts. 9,017
  6. Avatar for joremen 56. joremen Lv 1 34 pts. 9,008
  7. Avatar for jdormaar 57. jdormaar Lv 1 34 pts. 9,004
  8. Avatar for lilovip 58. lilovip Lv 1 33 pts. 8,996
  9. Avatar for TomTaylor 59. TomTaylor Lv 1 32 pts. 8,994
  10. Avatar for andrewxc 60. andrewxc Lv 1 31 pts. 8,994

Comments