Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907

  1. Avatar for Hiro Protagonist 11. Hiro Protagonist Lv 1 83 pts. 9,283
  2. Avatar for johnmitch 12. johnmitch Lv 1 81 pts. 9,282
  3. Avatar for Deleted player 13. Deleted player 79 pts. 9,273
  4. Avatar for BitSpawn 14. BitSpawn Lv 1 78 pts. 9,272
  5. Avatar for smilingone 15. smilingone Lv 1 76 pts. 9,267
  6. Avatar for LociOiling 16. LociOiling Lv 1 75 pts. 9,264
  7. Avatar for egran48 17. egran48 Lv 1 73 pts. 9,257
  8. Avatar for pmdpmd 18. pmdpmd Lv 1 72 pts. 9,255
  9. Avatar for grogar7 19. grogar7 Lv 1 70 pts. 9,253
  10. Avatar for frood66 20. frood66 Lv 1 69 pts. 9,253

Comments