Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,784
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,740
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,593
  4. Avatar for Deleted group 14. Deleted group pts. 8,578
  5. Avatar for Natural Abilities 15. Natural Abilities 2 pts. 8,484
  6. Avatar for Russian team 16. Russian team 1 pt. 8,271
  7. Avatar for SHELL 17. SHELL 1 pt. 8,169
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,821
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,739
  10. Avatar for freefolder 20. freefolder 1 pt. 7,175
  1. Avatar for drodriguez41912 231. drodriguez41912 Lv 1 1 pt. 6,505
  2. Avatar for slofgren 232. slofgren Lv 1 1 pt. 6,410
  3. Avatar for jermainiac 233. jermainiac Lv 1 1 pt. 6,397
  4. Avatar for Adonaj 234. Adonaj Lv 1 1 pt. 6,369
  5. Avatar for zlny 235. zlny Lv 1 1 pt. 6,331
  6. Avatar for kaiteyspringer 236. kaiteyspringer Lv 1 1 pt. 6,201
  7. Avatar for cqd123123 237. cqd123123 Lv 1 1 pt. 6,178
  8. Avatar for PavaniD 238. PavaniD Lv 1 1 pt. 5,201
  9. Avatar for nanou35 239. nanou35 Lv 1 1 pt. 5,031
  10. Avatar for manu8170 240. manu8170 Lv 1 1 pt. 2,955

Comments