Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,998
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 6 pts. 8,971
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,955
  4. Avatar for xkcd 14. xkcd 3 pts. 8,902
  5. Avatar for BCMB404-Fall2015 15. BCMB404-Fall2015 2 pts. 8,730
  6. Avatar for Androids 16. Androids 2 pts. 8,715
  7. Avatar for freefolder 17. freefolder 1 pt. 8,662
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,590
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 8,563
  10. Avatar for ROMANIA Team 20. ROMANIA Team 1 pt. 8,190

  1. Avatar for Deleted player 21. Deleted player pts. 9,164
  2. Avatar for KarenCH 22. KarenCH Lv 1 68 pts. 9,162
  3. Avatar for grogar7 23. grogar7 Lv 1 66 pts. 9,162
  4. Avatar for smilingone 24. smilingone Lv 1 65 pts. 9,153
  5. Avatar for nemo7731 25. nemo7731 Lv 1 64 pts. 9,150
  6. Avatar for gitwut 26. gitwut Lv 1 63 pts. 9,147
  7. Avatar for g_b 27. g_b Lv 1 61 pts. 9,143
  8. Avatar for WonkyDonkey 28. WonkyDonkey Lv 1 60 pts. 9,139
  9. Avatar for WarpSpeed 29. WarpSpeed Lv 1 59 pts. 9,138
  10. Avatar for jobo0502 30. jobo0502 Lv 1 58 pts. 9,134

Comments