Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for bamh 91. bamh Lv 1 14 pts. 8,828
  2. Avatar for manu8170 92. manu8170 Lv 1 14 pts. 8,826
  3. Avatar for ecali 93. ecali Lv 1 14 pts. 8,824
  4. Avatar for Vinara 94. Vinara Lv 1 13 pts. 8,816
  5. Avatar for leehaggis 95. leehaggis Lv 1 13 pts. 8,815
  6. Avatar for Glen B 96. Glen B Lv 1 13 pts. 8,813
  7. Avatar for tarimo 97. tarimo Lv 1 12 pts. 8,812
  8. Avatar for jtrube1 98. jtrube1 Lv 1 12 pts. 8,799
  9. Avatar for JUMELLE54 99. JUMELLE54 Lv 1 12 pts. 8,799
  10. Avatar for Iron pet 100. Iron pet Lv 1 11 pts. 8,793

Comments