Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for FreeFolder 121. FreeFolder Lv 1 6 pts. 8,721
  2. Avatar for PlagueRat 122. PlagueRat Lv 1 6 pts. 8,715
  3. Avatar for abiogenesis 123. abiogenesis Lv 1 6 pts. 8,710
  4. Avatar for Jim Fraser 124. Jim Fraser Lv 1 6 pts. 8,709
  5. Avatar for ManVsYard 125. ManVsYard Lv 1 5 pts. 8,698
  6. Avatar for TJOK fan 126. TJOK fan Lv 1 5 pts. 8,691
  7. Avatar for multaq 127. multaq Lv 1 5 pts. 8,691
  8. Avatar for Flagg65a 128. Flagg65a Lv 1 5 pts. 8,690
  9. Avatar for arginia 129. arginia Lv 1 5 pts. 8,687
  10. Avatar for przemek112233 130. przemek112233 Lv 1 5 pts. 8,687

Comments