Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for NameChangeNeeded01 161. NameChangeNeeded01 Lv 1 2 pts. 8,557
  2. Avatar for rinze 162. rinze Lv 1 2 pts. 8,554
  3. Avatar for Jaco van As 163. Jaco van As Lv 1 2 pts. 8,549
  4. Avatar for Sterh 164. Sterh Lv 1 2 pts. 8,536
  5. Avatar for loflav 165. loflav Lv 1 2 pts. 8,525
  6. Avatar for Mohambone 166. Mohambone Lv 1 2 pts. 8,523
  7. Avatar for mirjamvandelft 167. mirjamvandelft Lv 1 1 pt. 8,511
  8. Avatar for gdnskye 168. gdnskye Lv 1 1 pt. 8,508
  9. Avatar for harvardman 169. harvardman Lv 1 1 pt. 8,496
  10. Avatar for dahast.de 170. dahast.de Lv 1 1 pt. 8,492

Comments