Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for anderssundin 171. anderssundin Lv 1 1 pt. 8,487
  2. Avatar for JinniaFlyer450 172. JinniaFlyer450 Lv 1 1 pt. 8,476
  3. Avatar for Petrifolder 173. Petrifolder Lv 1 1 pt. 8,466
  4. Avatar for lange 174. lange Lv 1 1 pt. 8,442
  5. Avatar for Altercomp 175. Altercomp Lv 1 1 pt. 8,436
  6. Avatar for vuvuvu 176. vuvuvu Lv 1 1 pt. 8,436
  7. Avatar for Tyrone Shoelaces 177. Tyrone Shoelaces Lv 1 1 pt. 8,434
  8. Avatar for AEJensen 178. AEJensen Lv 1 1 pt. 8,412
  9. Avatar for Sydefecks 179. Sydefecks Lv 1 1 pt. 8,411
  10. Avatar for Superphosphate 180. Superphosphate Lv 1 1 pt. 8,397

Comments