Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for gmn 11. gmn Lv 1 84 pts. 9,216
  2. Avatar for mimi 12. mimi Lv 1 82 pts. 9,202
  3. Avatar for BitSpawn 13. BitSpawn Lv 1 81 pts. 9,202
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 79 pts. 9,195
  5. Avatar for Vredeman 15. Vredeman Lv 1 78 pts. 9,195
  6. Avatar for sheerbliss 16. sheerbliss Lv 1 76 pts. 9,194
  7. Avatar for hpaege 17. hpaege Lv 1 75 pts. 9,192
  8. Avatar for nicobul 18. nicobul Lv 1 73 pts. 9,185
  9. Avatar for pauldunn 19. pauldunn Lv 1 72 pts. 9,177
  10. Avatar for aznarog 20. aznarog Lv 1 70 pts. 9,166

Comments