Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for Thebatman012 191. Thebatman012 Lv 1 1 pt. 8,306
  2. Avatar for morris3190 192. morris3190 Lv 1 1 pt. 8,300
  3. Avatar for huthmama 193. huthmama Lv 1 1 pt. 8,290
  4. Avatar for Ragas 194. Ragas Lv 1 1 pt. 8,279
  5. Avatar for binary101010 195. binary101010 Lv 1 1 pt. 8,279
  6. Avatar for lacie 196. lacie Lv 1 1 pt. 8,276
  7. Avatar for pytmich 197. pytmich Lv 1 1 pt. 8,273
  8. Avatar for Froobyflake 198. Froobyflake Lv 1 1 pt. 8,266
  9. Avatar for Arne Heessels 199. Arne Heessels Lv 1 1 pt. 8,266
  10. Avatar for Aldrovanda 200. Aldrovanda Lv 1 1 pt. 8,265

Comments