Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for Jorge Cantero 211. Jorge Cantero Lv 1 1 pt. 8,200
  2. Avatar for skygge 212. skygge Lv 1 1 pt. 8,197
  3. Avatar for brgreening 213. brgreening Lv 1 1 pt. 8,195
  4. Avatar for Shai 214. Shai Lv 1 1 pt. 8,190
  5. Avatar for plh 215. plh Lv 1 1 pt. 8,183
  6. Avatar for Pioxolotl 216. Pioxolotl Lv 1 1 pt. 8,168
  7. Avatar for jlj001 217. jlj001 Lv 1 1 pt. 8,163
  8. Avatar for kwycisk 218. kwycisk Lv 1 1 pt. 8,161
  9. Avatar for serderic 219. serderic Lv 1 1 pt. 8,158
  10. Avatar for franse 220. franse Lv 1 1 pt. 8,157

Comments