Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for pawelski 251. pawelski Lv 1 1 pt. 7,634
  2. Avatar for agnairt 252. agnairt Lv 1 1 pt. 7,580
  3. Avatar for basas 253. basas Lv 1 1 pt. 7,485
  4. Avatar for ivalnic 254. ivalnic Lv 1 1 pt. 7,425
  5. Avatar for yichengxu 255. yichengxu Lv 1 1 pt. 7,393
  6. Avatar for Gabecoolio 256. Gabecoolio Lv 1 1 pt. 7,273
  7. Avatar for phillip39howard 257. phillip39howard Lv 1 1 pt. 7,213
  8. Avatar for aspadistra 258. aspadistra Lv 1 1 pt. 7,202
  9. Avatar for sailboat13 259. sailboat13 Lv 1 1 pt. 7,090
  10. Avatar for Pyotr 260. Pyotr Lv 1 1 pt. 6,701

Comments