Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for Simo_Baro3 261. Simo_Baro3 Lv 1 1 pt. 6,650
  2. Avatar for IvanoDivano 262. IvanoDivano Lv 1 1 pt. 6,419
  3. Avatar for Bioboy1973 263. Bioboy1973 Lv 1 1 pt. 6,416
  4. Avatar for smholst 264. smholst Lv 1 1 pt. 5,834
  5. Avatar for ValterPrado 265. ValterPrado Lv 1 1 pt. 5,498
  6. Avatar for zkm 266. zkm Lv 1 1 pt. 5,007
  7. Avatar for bbbrandon 267. bbbrandon Lv 1 1 pt. 2,560
  8. Avatar for Deleted player 268. Deleted player pts. 2,560
  9. Avatar for StefanAuf92 269. StefanAuf92 Lv 1 1 pt. 2,560
  10. Avatar for dflear 270. dflear Lv 1 1 pt. 2,560

Comments