Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for Galaxie 31. Galaxie Lv 1 57 pts. 9,124
  2. Avatar for cbwest 32. cbwest Lv 1 55 pts. 9,119
  3. Avatar for Mark A 33. Mark A Lv 1 54 pts. 9,119
  4. Avatar for TomTaylor 34. TomTaylor Lv 1 53 pts. 9,110
  5. Avatar for Grom 35. Grom Lv 1 52 pts. 9,096
  6. Avatar for actiasluna 36. actiasluna Lv 1 51 pts. 9,096
  7. Avatar for Tweedle Dumb 37. Tweedle Dumb Lv 1 50 pts. 9,095
  8. Avatar for Deleted player 38. Deleted player 49 pts. 9,093
  9. Avatar for Paulo Roque 39. Paulo Roque Lv 1 48 pts. 9,081
  10. Avatar for weitzen 40. weitzen Lv 1 47 pts. 9,070

Comments