Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for uhuuhu 41. uhuuhu Lv 1 46 pts. 9,069
  2. Avatar for diamond_dust 42. diamond_dust Lv 1 45 pts. 9,065
  3. Avatar for joremen 43. joremen Lv 1 44 pts. 9,065
  4. Avatar for christioanchauvin 44. christioanchauvin Lv 1 43 pts. 9,063
  5. Avatar for Anfinsen_slept_here 45. Anfinsen_slept_here Lv 1 42 pts. 9,062
  6. Avatar for pmdpmd 46. pmdpmd Lv 1 41 pts. 9,055
  7. Avatar for pvc78 47. pvc78 Lv 1 41 pts. 9,054
  8. Avatar for Museka 48. Museka Lv 1 40 pts. 9,050
  9. Avatar for dcrwheeler 49. dcrwheeler Lv 1 39 pts. 9,047
  10. Avatar for O Seki To 50. O Seki To Lv 1 38 pts. 9,046

Comments