Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for cobaltteal 51. cobaltteal Lv 1 37 pts. 9,038
  2. Avatar for MaartenDesnouck 52. MaartenDesnouck Lv 1 36 pts. 9,028
  3. Avatar for Timo van der Laan 53. Timo van der Laan Lv 1 36 pts. 9,025
  4. Avatar for SKSbell 54. SKSbell Lv 1 35 pts. 9,004
  5. Avatar for pmthomson90 55. pmthomson90 Lv 1 34 pts. 8,998
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 33 pts. 8,993
  7. Avatar for mitarcher 57. mitarcher Lv 1 33 pts. 8,989
  8. Avatar for shettler 58. shettler Lv 1 32 pts. 8,987
  9. Avatar for dbuske 59. dbuske Lv 1 31 pts. 8,986
  10. Avatar for Hiro Protagonist 60. Hiro Protagonist Lv 1 30 pts. 8,971

Comments