Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for traal 61. traal Lv 1 30 pts. 8,970
  2. Avatar for t012 62. t012 Lv 1 29 pts. 8,961
  3. Avatar for kitek314_pl 63. kitek314_pl Lv 1 28 pts. 8,955
  4. Avatar for isaksson 64. isaksson Lv 1 28 pts. 8,953
  5. Avatar for Blipperman 65. Blipperman Lv 1 27 pts. 8,949
  6. Avatar for Simek 66. Simek Lv 1 26 pts. 8,944
  7. Avatar for SouperGenious 67. SouperGenious Lv 1 26 pts. 8,930
  8. Avatar for andrewxc 68. andrewxc Lv 1 25 pts. 8,919
  9. Avatar for alwen 69. alwen Lv 1 25 pts. 8,915
  10. Avatar for jamiexq 70. jamiexq Lv 1 24 pts. 8,911

Comments