Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for JackONeill12 71. JackONeill12 Lv 1 24 pts. 8,910
  2. Avatar for ponderosa 72. ponderosa Lv 1 23 pts. 8,903
  3. Avatar for fryguy 73. fryguy Lv 1 22 pts. 8,902
  4. Avatar for goastano 74. goastano Lv 1 22 pts. 8,902
  5. Avatar for caglar 75. caglar Lv 1 21 pts. 8,900
  6. Avatar for gurch 76. gurch Lv 1 21 pts. 8,896
  7. Avatar for sharondipity 77. sharondipity Lv 1 20 pts. 8,896
  8. Avatar for dettingen 78. dettingen Lv 1 20 pts. 8,891
  9. Avatar for tallguy-13088 79. tallguy-13088 Lv 1 19 pts. 8,883
  10. Avatar for Idiotboy 80. Idiotboy Lv 1 19 pts. 8,883

Comments