Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359

  1. Avatar for Tweedle Dumb 101. Tweedle Dumb Lv 1 11 pts. 8,642
  2. Avatar for johngran 102. johngran Lv 1 11 pts. 8,636
  3. Avatar for kitek314_pl 103. kitek314_pl Lv 1 10 pts. 8,631
  4. Avatar for mmrenaut 104. mmrenaut Lv 1 10 pts. 8,615
  5. Avatar for SKSbell 105. SKSbell Lv 1 10 pts. 8,614
  6. Avatar for Paulo Roque 106. Paulo Roque Lv 1 10 pts. 8,597
  7. Avatar for georg137 107. georg137 Lv 1 9 pts. 8,595
  8. Avatar for ManVsYard 108. ManVsYard Lv 1 9 pts. 8,586
  9. Avatar for Jajaboman 109. Jajaboman Lv 1 9 pts. 8,583
  10. Avatar for ponderosa 110. ponderosa Lv 1 9 pts. 8,572

Comments