Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,385
  2. Avatar for Go Science 2. Go Science 81 pts. 9,380
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,343
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,341
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,300
  6. Avatar for Void Crushers 6. Void Crushers 32 pts. 9,258
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,209
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,028
  1. Avatar for Tweedle Dumb 101. Tweedle Dumb Lv 1 11 pts. 8,642
  2. Avatar for johngran 102. johngran Lv 1 11 pts. 8,636
  3. Avatar for kitek314_pl 103. kitek314_pl Lv 1 10 pts. 8,631
  4. Avatar for mmrenaut 104. mmrenaut Lv 1 10 pts. 8,615
  5. Avatar for SKSbell 105. SKSbell Lv 1 10 pts. 8,614
  6. Avatar for Paulo Roque 106. Paulo Roque Lv 1 10 pts. 8,597
  7. Avatar for georg137 107. georg137 Lv 1 9 pts. 8,595
  8. Avatar for ManVsYard 108. ManVsYard Lv 1 9 pts. 8,586
  9. Avatar for Jajaboman 109. Jajaboman Lv 1 9 pts. 8,583
  10. Avatar for ponderosa 110. ponderosa Lv 1 9 pts. 8,572

Comments