Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359
  1. Avatar for Vinara 141. Vinara Lv 1 3 pts. 8,193
  2. Avatar for Psych0Active 142. Psych0Active Lv 1 3 pts. 8,189
  3. Avatar for hada 143. hada Lv 1 3 pts. 8,184
  4. Avatar for proteansoup 144. proteansoup Lv 1 3 pts. 8,164
  5. Avatar for jtrube1 145. jtrube1 Lv 1 3 pts. 8,138
  6. Avatar for DScott 146. DScott Lv 1 3 pts. 8,127
  7. Avatar for Exonx 147. Exonx Lv 1 3 pts. 8,118
  8. Avatar for FreeFolder 148. FreeFolder Lv 1 3 pts. 8,109
  9. Avatar for Pibeagles 149. Pibeagles Lv 1 3 pts. 8,084
  10. Avatar for abiogenesis 150. abiogenesis Lv 1 3 pts. 8,080

Comments