Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,385
  2. Avatar for Go Science 2. Go Science 81 pts. 9,380
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,343
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,341
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,300
  6. Avatar for Void Crushers 6. Void Crushers 32 pts. 9,258
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,209
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,028
  1. Avatar for Vinara 141. Vinara Lv 1 3 pts. 8,193
  2. Avatar for Psych0Active 142. Psych0Active Lv 1 3 pts. 8,189
  3. Avatar for hada 143. hada Lv 1 3 pts. 8,184
  4. Avatar for proteansoup 144. proteansoup Lv 1 3 pts. 8,164
  5. Avatar for jtrube1 145. jtrube1 Lv 1 3 pts. 8,138
  6. Avatar for DScott 146. DScott Lv 1 3 pts. 8,127
  7. Avatar for Exonx 147. Exonx Lv 1 3 pts. 8,118
  8. Avatar for FreeFolder 148. FreeFolder Lv 1 3 pts. 8,109
  9. Avatar for Pibeagles 149. Pibeagles Lv 1 3 pts. 8,084
  10. Avatar for abiogenesis 150. abiogenesis Lv 1 3 pts. 8,080

Comments