Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359

  1. Avatar for KarenCH 11. KarenCH Lv 1 84 pts. 9,268
  2. Avatar for gmn 12. gmn Lv 1 82 pts. 9,259
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 81 pts. 9,258
  4. Avatar for actiasluna 14. actiasluna Lv 1 79 pts. 9,252
  5. Avatar for Deleted player 15. Deleted player pts. 9,246
  6. Avatar for Vredeman 16. Vredeman Lv 1 76 pts. 9,242
  7. Avatar for g_b 17. g_b Lv 1 75 pts. 9,231
  8. Avatar for retiredmichael 18. retiredmichael Lv 1 73 pts. 9,226
  9. Avatar for Galaxie 19. Galaxie Lv 1 72 pts. 9,218
  10. Avatar for johnmitch 20. johnmitch Lv 1 70 pts. 9,217

Comments