1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Summary

• Created: October 21, 2015
• Expires: October 28, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

• 1. Contenders 100 pts. 9,385
• 2. Go Science 81 pts. 9,380
• 3. Gargleblasters 65 pts. 9,343
• 4. Beta Folders 52 pts. 9,341
• 5. Anthropic Dreams 41 pts. 9,300
• 6. Void Crushers 32 pts. 9,258
• 7. HMT heritage 24 pts. 9,242
• 8. L'Alliance Francophone 18 pts. 9,209
• 9. Italiani Al Lavoro 14 pts. 9,120
• 10. Deleted group pts. 9,028

Top soloists

• 11. KarenCH 84 pts. 9,268
• 12. gmn 82 pts. 9,259
• 13. Timo van der Laan 81 pts. 9,258
• 14. actiasluna 79 pts. 9,252
• 15. Deleted player pts. 9,246
• 16. Vredeman 76 pts. 9,242
• 17. g_b 75 pts. 9,231
• 18. retiredmichael 73 pts. 9,226
• 19. Galaxie 72 pts. 9,218
• 20. johnmitch 70 pts. 9,217