Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359
  1. Avatar for isaksson 71. isaksson Lv 1 24 pts. 8,873
  2. Avatar for Mohambone 72. Mohambone Lv 1 23 pts. 8,872
  3. Avatar for tallguy-13088 73. tallguy-13088 Lv 1 22 pts. 8,859
  4. Avatar for nemo7731 74. nemo7731 Lv 1 22 pts. 8,839
  5. Avatar for dettingen 75. dettingen Lv 1 21 pts. 8,839
  6. Avatar for harvardman 76. harvardman Lv 1 21 pts. 8,823
  7. Avatar for goastano 77. goastano Lv 1 20 pts. 8,820
  8. Avatar for pfirth 78. pfirth Lv 1 20 pts. 8,817
  9. Avatar for guineapig 79. guineapig Lv 1 19 pts. 8,810
  10. Avatar for marie.p 80. marie.p Lv 1 19 pts. 8,810

Comments