Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Contenders 100 pts. 9,385
  2. Avatar for Go Science 2. Go Science 81 pts. 9,380
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,343
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,341
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,300
  6. Avatar for Void Crushers 6. Void Crushers 32 pts. 9,258
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,209
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,028

  1. Avatar for isaksson 71. isaksson Lv 1 24 pts. 8,873
  2. Avatar for Mohambone 72. Mohambone Lv 1 23 pts. 8,872
  3. Avatar for tallguy-13088 73. tallguy-13088 Lv 1 22 pts. 8,859
  4. Avatar for nemo7731 74. nemo7731 Lv 1 22 pts. 8,839
  5. Avatar for dettingen 75. dettingen Lv 1 21 pts. 8,839
  6. Avatar for harvardman 76. harvardman Lv 1 21 pts. 8,823
  7. Avatar for goastano 77. goastano Lv 1 20 pts. 8,820
  8. Avatar for pfirth 78. pfirth Lv 1 20 pts. 8,817
  9. Avatar for guineapig 79. guineapig Lv 1 19 pts. 8,810
  10. Avatar for marie.p 80. marie.p Lv 1 19 pts. 8,810

Comments