Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437

  1. Avatar for MaartenDesnouck 121. MaartenDesnouck Lv 1 6 pts. 8,435
  2. Avatar for fpc 122. fpc Lv 1 6 pts. 8,428
  3. Avatar for justjustin 123. justjustin Lv 1 6 pts. 8,410
  4. Avatar for lamoille 124. lamoille Lv 1 6 pts. 8,395
  5. Avatar for trebach 125. trebach Lv 1 5 pts. 8,394
  6. Avatar for brgreening 126. brgreening Lv 1 5 pts. 8,376
  7. Avatar for steveB 127. steveB Lv 1 5 pts. 8,359
  8. Avatar for atlas100 128. atlas100 Lv 1 5 pts. 8,356
  9. Avatar for rezaefar 129. rezaefar Lv 1 5 pts. 8,339
  10. Avatar for Cyberkashi 130. Cyberkashi Lv 1 5 pts. 8,324

Comments