Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for Arne Heessels 161. Arne Heessels Lv 1 2 pts. 7,993
  2. Avatar for pandabearsecond 162. pandabearsecond Lv 1 2 pts. 7,941
  3. Avatar for anderssundin 163. anderssundin Lv 1 2 pts. 7,923
  4. Avatar for jebbiek 164. jebbiek Lv 1 2 pts. 7,916
  5. Avatar for ncameron 165. ncameron Lv 1 2 pts. 7,909
  6. Avatar for gldisater 166. gldisater Lv 1 2 pts. 7,908
  7. Avatar for ivalnic 167. ivalnic Lv 1 1 pt. 7,900
  8. Avatar for Auntecedent 168. Auntecedent Lv 1 1 pt. 7,897
  9. Avatar for tela 169. tela Lv 1 1 pt. 7,888
  10. Avatar for Iron pet 170. Iron pet Lv 1 1 pt. 7,875

Comments