Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for ErazorOne 171. ErazorOne Lv 1 1 pt. 7,873
  2. Avatar for riley_choi 172. riley_choi Lv 1 1 pt. 7,869
  3. Avatar for inkycatz 173. inkycatz Lv 1 1 pt. 7,863
  4. Avatar for forest124124 174. forest124124 Lv 1 1 pt. 7,859
  5. Avatar for Wheeler22 175. Wheeler22 Lv 1 1 pt. 7,855
  6. Avatar for Sydefecks 176. Sydefecks Lv 1 1 pt. 7,847
  7. Avatar for rinze 177. rinze Lv 1 1 pt. 7,845
  8. Avatar for senor pit 178. senor pit Lv 1 1 pt. 7,840
  9. Avatar for NotJim99 179. NotJim99 Lv 1 1 pt. 7,811
  10. Avatar for monkry 180. monkry Lv 1 1 pt. 7,810

Comments